PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G200400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 202aa    MW: 21605.9 Da    PI: 5.2548
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G200400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.25.7e-38301301101
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca+dCvlapyfpa+qp+++a vh +FG+sn++++l++lp +er +a+++++ eA++r++dPvyG++g+i+ lqq+++ 
  Sobic.007G200400.1.p  30 RCAACKYLRRRCAPDCVLAPYFPASQPRRYADVHAVFGTSNLTRVLQSLPVQERGRAADTMATEAHWRVQDPVYGCTGIIHGLQQEIRD 118
                           6**************************************************************************************** PP

                DUF260  90 lkaelallkeel 101
                           ++++la+++++l
  Sobic.007G200400.1.p 119 VQQQLATTRAQL 130
                           *******99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.00929130IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-3830127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MSAGAGGGGG MEMDHQHPDS AGSATAVARR CAACKYLRRR CAPDCVLAPY FPASQPRRYA  60
DVHAVFGTSN LTRVLQSLPV QERGRAADTM ATEAHWRVQD PVYGCTGIIH GLQQEIRDVQ  120
QQLATTRAQL AMHLHGSGTA PPSSSPQPPL AAAAAATVTV NSGGRHRVSV HEDDEEQQQE  180
EEEEEAPLMD PDEFLDLDGR L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444738.11e-138hypothetical protein SORBIDRAFT_07g026800
SwissprotP594682e-38LBD24_ARATH; LOB domain-containing protein 24
TrEMBLC5YI861e-138C5YI86_SORBI; Putative uncharacterized protein Sb07g026800
STRINGSb07g026800.11e-137(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-36LOB domain-containing protein 4